Pfam domain
Pfam family: Med7 (PF05983.13)
Uniprot AC: Q08278
RecName: Mediator of RNA polymerase II transcription subunit 7
Begin-End: 15-203
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PPPPYVKFFTQSNLEKLPKYKEKKAASAKQTAPNNSNGGSEEEITCALDYLIPPPMPKNQ
QYRAFGSIWQVKDQLPDLESMGLTQLYKKSTENESTNYQYKIQELRKLLKSLLLNYLELI
GVLSINPDMYERKVENIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIEQ
VCKQVHDKL
Structures of the domain Q08278 15-203
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqm X-ray 5.8 i 30-203 None
5sva X-ray 15.3 U 11-203 None


© NPIDB team 2003 - 2021

text