Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: Q08874
RecName: Microphthalmia-associated transcription factor
Begin-End: 312-365
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Mj 

Sequence:
KKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQ
Structures of the domain Q08874 312-365
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ati X-ray 2.6 B 205-258  H-Bb H-Mj 
4ati X-ray 2.6 A 209-258  H-Bb H-Mj L-Mj 
4atk X-ray 2.95 A 207-258  H-Bb H-Mj L-Bb 
4atk X-ray 2.95 B 205-258  H-Bb H-Mj 
6g1l X-ray 2.4 A 205-258 None


© NPIDB team 2003 - 2021

text