Pfam domain
Pfam family: SSrecog (PF03531.16)
Uniprot AC: Q08945
RecName: FACT complex subunit SSRP1
Begin-End: 106-170
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRF
YVPPT
Structures of the domain Q08945 106-170
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6upl X-ray 7.4 H 106-170 None
6upk X-ray 4.9 H 106-170 None


© NPIDB team 2003 - 2021

text