Pfam domain
Pfam family: Rtt106 (PF08512.14)
Uniprot AC: Q08945
RecName: FACT complex subunit SSRP1
Begin-End: 339-427
Organism: Homo sapiens
Interaction Mode:   

Sequence:
QCITCSYKASSGLLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQG
TQYTFSSIEREEYGKLFDFVNAKKLNIKN
Structures of the domain Q08945 339-427
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6upl X-ray 7.4 H 339-427 None
6upk X-ray 4.9 H 339-427 None


© NPIDB team 2003 - 2021

text