Pfam domain
Pfam family: POB3_N (PF17292.4)
Uniprot AC: Q08945
RecName: FACT complex subunit SSRP1
Begin-End: 5-99
Organism: Homo sapiens
Interaction Mode:   

Sequence:
LEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGHGLKL
LTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELME
Structures of the domain Q08945 5-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6upl X-ray 7.4 H 5-99 None
6upk X-ray 4.9 H 5-99 None


© NPIDB team 2003 - 2021

text