Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: Q08963
RecName: U2 small nuclear ribonucleoprotein A'
Begin-End: 13-73
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QYYVDHFNGKYNVDKCVILRDLQLETDSESMPSSLKHLTKPTHILDLTNNDLIMIPDLSR
R
Structures of the domain Q08963 13-73
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bk8 X-ray 3.3 S 12-75 None


© NPIDB team 2003 - 2021

text