Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q08AJ9
RecName: Histone H2A
Begin-End: 12-91
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAA
RDNKKTRIIPRHLQLAIRND
Structures of the domain Q08AJ9 12-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6v2k X-ray 2.6 C 11-90  H-Bb S-Bb L-Bb 
6v2k X-ray 2.6 G 15-90  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text