Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: Q08IE6
RecName: High mobility group protein B1
Begin-End: 99-136
Organism: Equus caballus
Interaction Mode:   

Sequence:
PSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNT
Structures of the domain Q08IE6 99-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oer X-ray 3.29 H 99-136  H-Bb H-Mn L-Mn 


© NPIDB team 2003 - 2021

text