Pfam domain
Pfam family: Sigma70_r2 (PF04542.16)
Uniprot AC: Q0P6L9
RecName: RNA polymerase sigma factor RpoD
Begin-End: 379-449
Organism: Escherichia coli
Interaction Mode:   

Sequence:
MVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQA
ITRSIADQART
Structures of the domain Q0P6L9 379-449
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n62 X-ray 3.8 F 379-449  H-Bb H-Mj H-Mn 
6n61 X-ray 3.25 F 379-449  H-Bb H-Mj H-Mn L-Bb 
6n60 X-ray 3.68 F 379-449  H-Bb H-Mj 
6wmu X-ray 3.18 F 379-449  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text