Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: Q0P6L9
RecName: RNA polymerase sigma factor RpoD
Begin-End: 458-535
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDS
HLGDFIEDTTLELPLDSA
Structures of the domain Q0P6L9 458-535
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n62 X-ray 3.8 F 458-535  H-Bb 
6n61 X-ray 3.25 F 458-535  H-Bb 
6n60 X-ray 3.68 F 458-535  H-Bb 
6wmu X-ray 3.18 F 458-535  H-Bb 


© NPIDB team 2003 - 2021

text