Pfam domain
Pfam family: Sigma70_r4 (PF04545.18)
Uniprot AC: Q0P6L9
RecName: RNA polymerase sigma factor RpoD
Begin-End: 547-600
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRH
Structures of the domain Q0P6L9 547-600
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6n62 X-ray 3.8 F 547-600 None
6n61 X-ray 3.25 F 547-600 None
6n60 X-ray 3.68 F 547-600 None
6wmu X-ray 3.18 F 547-600  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text