Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: Q0QHL8
RecName: Telomerase reverse transcriptase
Begin-End: 187-391
Organism: Tribolium castaneum
Interaction Mode:   

Sequence:
IPKQDNFRAIVSIFPDSARKPFFKLLTSKIYKVLEEKYKTSGSLYTCWSEFTQKTQGQIY
GIKVDIRDAYGNVKIPVLCKLIQSIPTHLLDSEKKNFIVDHISNQFVAFRRKIYKWNHGL
LQGDPLSGCLCELYMAFMDRLYFSNLDKDAFIHRTVDDYFFCSPHPHKVYDFELLIKGVY
QVNPTKTRTNLPTHRHPQDEIPYCG
Structures of the domain Q0QHL8 187-391
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6e53 X-ray 2.8 A 187-391 None
3kyl X-ray 2.7 A 187-391 None
6usp X-ray 3.56 A 187-391 None
6usq X-ray 3.62 A 187-391 None
6uso X-ray 2.54 A 187-391 None
6usr X-ray 2.93 A 187-391 None


© NPIDB team 2003 - 2021

text