Pfam domain
Pfam family: Tfb4 (PF03850.16)
Uniprot AC: Q12004
RecName: General transcription and DNA repair factor IIH subunit TFB4
Begin-End: 23-309
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
PSLLTVIIEIAPKLWTTFDEEGNEKGSIIKVLEALIVFLNAHLAFNSANKVAVIAAYSQG
IKYLYPESTSALKASESENKTRSDLKIINSDMYRRFRNVDETLVEEIYKLFELEKKQIEQ
NSQRSTLAGAMSAGLTYVNRISKESVTTSLKSRLLVLTCGSGSSKDEIFQYIPIMNCIFS
ATKMKCPIDVVKIGGSKESTFLQQTTDATNGVYLHVESTEGLIQYLATAMFIDPSLRPII
VKPNHGSVDFRTSCYLTGRVVAVGFICSVCLCVLSIIPPGNKCPACD
Structures of the domain Q12004 23-309
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 4 23-309 None
5oqm X-ray 5.8 4 23-309 None
6gym X-ray 6.7 4 23-309 None


© NPIDB team 2003 - 2021

text