Pfam domain
Pfam family: Sld5 (PF05916.13)
Uniprot AC: Q12146
RecName: DNA replication complex GINS protein PSF3
Begin-End: 44-174
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LSLPLWLARILAIVGGDEALVDEEPVPFVELLPPDMFSTKVMNAIKTDPVALDLHSINSH
FFSLAIKWIMLFSEKELANVVSELLLQRAQELNHHASSLSIDLNADSTGKNSANTNIATS
TFLLKLEEMEK
Structures of the domain Q12146 44-174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u8t X-ray 4.9 C 44-178 None
5u8s X-ray 6.1 C 44-178 None
6u0m X-ray 3.9 C 44-178 None
6hv9 X-ray 4.98 E 44-178 None


© NPIDB team 2003 - 2021

text