Pfam domain
Pfam family: Med4 (PF10018.11)
Uniprot AC: Q12343
RecName: Mediator of RNA polymerase II transcription subunit 4
Begin-End: 67-127
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELK
A
Structures of the domain Q12343 67-127
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5sva X-ray 15.3 T 67-127 None


© NPIDB team 2003 - 2021

text