Pfam domain
Pfam family: Actin (PF00022.21)
Uniprot AC: Q12406
RecName: Actin-related protein 7
Begin-End: 2-466
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TLNRKCVVIHNGSHRTVAGFSNVELPQCIIPSSYIKRTDEGGEAEFIFGTYNMIDAAAEK
RNGDEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKVSPEELPLVITMPATNGKPDMAILE
RYYELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVR
SKFGGDFLDFQVHERLAPLIKEENDMENMADEQKRSTDVWYEASTWIQQFKSTMLQVSEK
DLFELERYYKEQADIYAKQQEQLKQMDQQLQYTALTGSPNNPLVQKKNFLFKPLNKTLTL
DLKECYQFAEYLFKPQLISDKFSPEDGLGPLMAKSVKKAGASINSMKANTSTNPNGLGTS
HINTNVGDNNSTASSSNISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKL
TTFANQVMMDRKIQGWLGALTMANLPSWSLGKWYSKEDYETLKRD
Structures of the domain Q12406 2-466
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kw4 X-ray 7.55 f 2-464 None
6kw3 X-ray 7.13 f 317-464 None
6uxw X-ray 8.96 P 2-464 None
6kw5 X-ray 10.13 f 2-464 None
6tda X-ray 15 T 2-464 None
6v92 X-ray 20 A 38-464 None
6vz4 X-ray 3.9 L 2-464 None


© NPIDB team 2003 - 2021

text