Pfam domain
Pfam family: Tfb4 (PF03850.16)
Uniprot AC: Q13889
RecName: General transcription factor IIH subunit 3
Begin-End: 2-81
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIA
SHIQESRFLYPGKNGRLGDF
Structures of the domain Q13889 2-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ro4 X-ray 3.5 E 8-116 None


© NPIDB team 2003 - 2021

text