Pfam domain
Pfam family: MCM_OB (PF17207.5)
Uniprot AC: Q14566
RecName: DNA replication licensing factor MCM6
Begin-End: 122-252
Organism: Homo sapiens
Interaction Mode:   

Sequence:
KIRELTSSRIGLLTRISGQVVRTHPVHPELVSGTFLCLDCQTVIRDVEQQFKYTQPNICR
NPVCANRRRFLLDTNKSRFVDFQKVRIQETQAELPRGSIPRSLEVILRAEAVESAQAGDK
CDFTGTLIVVP
Structures of the domain Q14566 122-252
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6xtx X-ray 3.29 6 122-252 None


© NPIDB team 2003 - 2021

text