Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: Q14839
RecName: Chromodomain-helicase-DNA-binding protein 4
Begin-End: 728-1025
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTI
INWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKEASVKFHV
LLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQN
NLEELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMP
SKTELIVRVELSPMQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLF
Structures of the domain Q14839 728-1025
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ryr X-ray 3.1 W 726-1025 None
6ryu X-ray 4 V 726-1025 None
6ryu X-ray 4 W 726-1025 None


© NPIDB team 2003 - 2021

text