Pfam domain
Pfam family: Pou (PF00157.19)
Uniprot AC: Q14863
RecName: POU domain, class 6, transcription factor 1
Begin-End: 143-213
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
NLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLK
PVLEKWLNEAE
Structures of the domain Q14863 143-213
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3d1n X-ray 2.51 L 143-213  H-Bb H-Mj L-Bb 
3d1n X-ray 2.51 K 143-213  H-Bb H-Mj L-Mj 
3d1n X-ray 2.51 J 142-213  H-Bb H-Mj 
3d1n X-ray 2.51 I 143-213  H-Bb H-Mj L-Mj 
3d1n X-ray 2.51 P 143-213  H-Bb H-Mj L-Bb 
3d1n X-ray 2.51 O 143-213  H-Bb H-Mj L-Mj 
3d1n X-ray 2.51 N 143-213  H-Bb H-Mj L-Bb 
3d1n X-ray 2.51 M 143-213  H-Bb H-Mj L-Mj 


© NPIDB team 2003 - 2021

text