Pfam domain
Pfam family: VEFS-Box (PF09733.11)
Uniprot AC: Q15022
RecName: Polycomb protein SUZ12
Begin-End: 562-680
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHV
MKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTK
Structures of the domain Q15022 562-680
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7at8 X-ray 4.4 C 562-680 None


© NPIDB team 2003 - 2021

text