Pfam domain
Pfam family: Homeobox_KN (PF05920.13)
Uniprot AC: Q15583
RecName: Homeobox protein TGIF1
Begin-End: 182-221
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
WLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRR
Structures of the domain Q15583 182-221
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fqq X-ray 3.25 E 182-221  H-Bb H-Mj L-Bb 
6fqq X-ray 3.25 D 182-221 None
6fqq X-ray 3.25 B 182-221  H-Bb H-Mj L-Bb 
6fqq X-ray 3.25 A 182-221  H-Bb H-Mj L-Bb 
6fqp X-ray 2.42 A 182-221  H-Bb H-Mj L-Bb 
6fqp X-ray 2.42 B 182-221  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text