Pfam domain
Pfam family: preSET_CXC (PF18264.3)
Uniprot AC: Q15910
RecName: Histone-lysine N-methyltransferase EZH2
Begin-End: 559-590
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GCRCKAQCNTKQCPCYLAVRECDPDLCLTCGA
Structures of the domain Q15910 559-590
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7at8 X-ray 4.4 A 577-608 None


© NPIDB team 2003 - 2021

text