Pfam domain
Pfam family: SET (PF00856.30)
Uniprot AC: Q15910
RecName: Histone-lysine N-methyltransferase EZH2
Begin-End: 623-727
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGN
KIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYR
Structures of the domain Q15910 623-727
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7at8 X-ray 4.4 A 641-745 None


© NPIDB team 2003 - 2021

text