Pfam domain
Pfam family: MMS1_N (PF10433.11)
Uniprot AC: Q16531
RecName: DNA damage-binding protein 1
Begin-End: 75-392
Organism: Homo sapiens
Interaction Mode:   

Sequence:
DLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLR
LYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYE
VSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIK
QSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECL
TYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQ
LVTCSGAFKEGSLRIIRN
Structures of the domain Q16531 75-392
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6r8y X-ray 4.3 K 75-724 None
4a0a X-ray 3.6 A 75-724 None
6r8z X-ray 3.9 K 75-724 None
6r90 X-ray 4.5 K 75-724 None
6r92 X-ray 4.8 K 75-724 None
6r91 X-ray 4.1 K 75-724 None


© NPIDB team 2003 - 2021

text