Pfam domain
Pfam family: CPSF_A (PF03178.17)
Uniprot AC: Q16531
RecName: DNA damage-binding protein 1
Begin-End: 788-1099
Organism: Homo sapiens
Interaction Mode:   

Sequence:
VHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGR
IVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELRTECNHYN
NIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLG
AENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGS
VLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATG
FIDGDLIESFLD
Structures of the domain Q16531 788-1099
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3ei2 X-ray 2.6 A 788-1099 None
4a09 X-ray 3.1 A 788-1099 None
6r8y X-ray 4.3 K 788-1099 None
4e54 X-ray 2.85 A 788-1099 None
4a08 X-ray 3 A 788-1099 None
4a0l X-ray 7.4 C 788-1099 None
4a0l X-ray 7.4 A 788-1099 None
4a0b X-ray 3.8 C 788-1099 None
4a0b X-ray 3.8 A 788-1099 None
4a0k X-ray 5.93 C 788-1099 None
4e5z X-ray 3.22 A 788-1099 None
3ei1 X-ray 2.8 A 788-1099 None
4a0a X-ray 3.6 A 788-1099 None
6r8z X-ray 3.9 K 788-1099 None
6r90 X-ray 4.5 K 788-1099 None
6r92 X-ray 4.8 K 788-1099 None
6r91 X-ray 4.1 K 788-1099 None


© NPIDB team 2003 - 2021

text