Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: Q16778
RecName: Histone H2B type 2-E
Begin-End: 34-102
Organism: Homo sapiens
Interaction Mode:   

Sequence:
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSR
EIQTAVRLL
Structures of the domain Q16778 34-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6m4h X-ray 3.9 D 36-101  L-Bb 
6m4h X-ray 3.9 H 36-101  L-Bb 
6m4g X-ray 2.8 D 36-101  L-Bb 
6m4g X-ray 2.8 H 36-101  L-Bb 
6m4d X-ray 4.4 H 33-101  H-Bb S-Bb L-Bb 
6m4d X-ray 4.4 D 33-101  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text