Pfam domain
Pfam family: XPG_I (PF00867.20)
Uniprot AC: Q17RS7
RecName: Flap endonuclease GEN homolog 1
Begin-End: 125-208
Organism: Homo sapiens
Interaction Mode:   

Sequence:
GIPWVQAAGEAEAMCAYLNAGGHVDGCLTNDGDTFLYGAQTVYRNFTMNTKDPHVDCYTM
SSIKSKLGLDRDALVGLAILLGCD
Structures of the domain Q17RS7 125-208
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5t9j X-ray 3 B 125-208  L-Bb 
5t9j X-ray 3 A 125-208  L-Bb 
5t9j X-ray 3 A 125-208  L-Bb 


© NPIDB team 2003 - 2021

text