Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: Q1D4I5
RecName: Transcriptional regulator, TetR family
Begin-End: 18-64
Organism: Myxococcus xanthus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
ILETAARLICDRGYEGTSMQEIAAACRMTKAGLYHHIQNKEQLLFAI
Structures of the domain Q1D4I5 18-64
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5k7z X-ray 2.92 C 18-64 None
5k7z X-ray 2.92 D 18-64 None
5k7z X-ray 2.92 B 18-64  H-Bb H-Mj 
5k7z X-ray 2.92 A 18-64  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text