Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: Q1JSZ0
RecName: 40S ribosomal protein S4
Begin-End: 43-90
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
PLVVLLRNRLRYALTYREVMMIVMQRLIKVDNKVRTDQCYPAGFMDVI
Structures of the domain Q1JSZ0 43-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 E 42-90 None


© NPIDB team 2003 - 2021

text