Pfam domain
Pfam family: ORC2 (PF04084.16)
Uniprot AC: Q24168
RecName: Origin recognition complex subunit 2
Begin-End: 323-606
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
AEHEGSINAIMEEYRSYFPKWMCILNEGFNILLYGLGSKHQLLQSFHREVLHKQTVLVVN
GFFPSLTIKDMLDSITSDILDAGISPANPHEAVDMIEEEFALIPETHLFLIVHNLDGAML
RNVKAQAILSRLARIPNIHLLASIDHINTPLLWDQGKLCSFNFSWWDCTTMLPYTNETAF
ENSLLVQNSGELALSSMRSVFSSLTTNSRGIYMLIVKYQLKNKGNATYQGMPFRDLYSSC
REAFLVSSDLALRAQLTEFLDHKLVKSKRSVDGSEQLTIPIDGA
Structures of the domain Q24168 323-606
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jk3 X-ray 3.4 B 280-606 None
7jk2 X-ray 3.2 B 280-606  S-Bb 
7jgs X-ray 3.2 B 280-606 None
7jgr X-ray 3.9 B 280-606 None
7jk4 X-ray 3.4 B 280-606 None


© NPIDB team 2003 - 2021

text