Pfam domain
Pfam family: ORC2 (PF04084.16)
Uniprot AC: Q24168
RecName: Origin recognition complex subunit 2
Begin-End: 328-502
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
SINAIMEEYRSYFPKWMCILNEGFNILLYGLGSKHQLLQSFHREVLHKQTVLVVNGFFPS
LTIKDMLDSITSDILDAGISPANPHEAVDMIEEEFALIPETHLFLIVHNLDGAMLRNVKA
QAILSRLARIPNIHLLASIDHINTPLLWDQGKLCSFNFSWWDCTTMLPYTNETAF
Structures of the domain Q24168 328-502
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jk5 X-ray 3.9 B 328-502  H-Bb 


© NPIDB team 2003 - 2021

text