Pfam domain
Pfam family: Dimer_Tnp_hAT (PF05699.16)
Uniprot AC: Q25438
RecName: Hermes transposase
Begin-End: 523-604
Organism: Musca domestica
Interaction Mode:  H-Bb H-Mn L-Bb L-Mn 

Sequence:
EFEFYRKEIVILSEDFKVMEWWNLNSKKYPKLSKLALSLLSIPASSAASERTFSLAGNII
TEKRNRIGQQTVDSLLFLNSFY
Structures of the domain Q25438 523-604
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dwz X-ray 3.2 E 523-604  H-Bb L-Mn 
6dwz X-ray 3.2 A 523-604  L-Bb L-Mn 
6dww X-ray 2.85 A 523-604  H-Bb H-Mn L-Bb L-Mn 
6dwy X-ray 3.2 A 523-604  H-Bb H-Mn L-Bb L-Mn 
6dx0 X-ray 2.9 A 523-604  H-Bb H-Mn L-Bb L-Mn 


© NPIDB team 2003 - 2021

text