Pfam domain
Pfam family: DBD_Tnp_Hermes (PF10683.11)
Uniprot AC: Q25438
RecName: Hermes transposase
Begin-End: 81-146
Organism: Musca domestica
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
RELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVKAEYGEHVNVEEL
LPSPIT
Structures of the domain Q25438 81-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dwz X-ray 3.2 E 81-146  H-Bb H-Mj L-Bb 
6dwz X-ray 3.2 A 81-146  H-Bb H-Mj L-Mj 
6dww X-ray 2.85 A 81-146  H-Bb H-Mj L-Bb 
6dwy X-ray 3.2 A 81-146  H-Bb H-Mj L-Bb 
6dx0 X-ray 2.9 A 81-146  H-Mj 


© NPIDB team 2003 - 2021

text