Pfam domain
Pfam family: DBD_Tnp_Hermes (PF10683.11)
Uniprot AC: Q25442
RecName: Transposase
Begin-End: 83-146
Organism: Musca domestica
Interaction Mode:   

Sequence:
LKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELLP
SPIT
Structures of the domain Q25442 83-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4d1q X-ray 3.4 H 83-146  H-Bb H-Mj 
4d1q X-ray 3.4 G 83-146  H-Bb H-Mj L-Bb 
4d1q X-ray 3.4 B 79-146  H-Bb H-Mj L-Bb 
4d1q X-ray 3.4 A 81-146  H-Bb H-Mj L-Mj 


© NPIDB team 2003 - 2021

text