Pfam domain
Pfam family: MCM_N (PF14551.8)
Uniprot AC: Q26454
RecName: DNA replication licensing factor MCM4
Begin-End: 165-267
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
KSKFKSFIMRFIDPSAEQDEISENIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQD
LYRQLICYPQEVIPGFDMAINEMFFERYPAALLEHQIQVRPFN
Structures of the domain Q26454 165-267
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 4 165-267 None
6ray X-ray 4.28 4 165-288 None
6raw X-ray 3.7 4 165-267 None
6raz X-ray 4.46 4 165-287 None


© NPIDB team 2003 - 2021

text