Pfam domain
Pfam family: MCM (PF00493.25)
Uniprot AC: Q26454
RecName: DNA replication licensing factor MCM4
Begin-End: 447-672
Organism: Drosophila melanogaster
Interaction Mode:   

Sequence:
RVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGRQNFRSEI
HLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALV
LADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQW
NKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLY
Structures of the domain Q26454 447-672
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rax X-ray 3.99 4 447-672 None
6ray X-ray 4.28 4 447-672 None
6raw X-ray 3.7 4 447-672 None
6raz X-ray 4.46 4 447-672 None


© NPIDB team 2003 - 2021

text