Pfam domain
Pfam family: NTP_transf_2 (PF01909.25)
Uniprot AC: Q29599
RecName: 2'-5'-oligoadenylate synthase 1
Begin-End: 36-129
Organism: Sus scrofa
Interaction Mode:   

Sequence:
VCRFLKERCFQGTADPVRVSKVVKGGSSGKGTTLRGRSDADLVVFLTKLTSFEDQLRRRG
EFIQEIRRQLEACQREQKFKVTFEVQSPRRENPR
Structures of the domain Q29599 36-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4rwn X-ray 2 A 36-129 None
4rwo X-ray 2.2 A 36-129 None
4rwp X-ray 2.25 A 36-129 None


© NPIDB team 2003 - 2021

text