Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: Q29RU1
RecName: 28S ribosomal protein S12, mitochondrial
Begin-End: 43-139
Organism: Bos taurus
Interaction Mode:   

Sequence:
KFPPSKPGPTEGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHNL
QEHHVVLVQGGRTQDLPGVKLKVVRGKYDCGHVQKKK
Structures of the domain Q29RU1 43-139
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6nf8 X-ray 3.48 L 43-139 None
6neq X-ray 3.32 L 43-139 None
3jd5 X-ray 7 L 43-139 None


© NPIDB team 2003 - 2021

text