Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: Q2A1M7
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 516-584
Organism: Francisella tularensis subsp. holarctica
Interaction Mode:   

Sequence:
QFMDQDNPLSEVTHKRRISALGPGGLSRDRAGFEVRDVHATHYGRLCPIETPEGPNIGLI
NSLASYARV
Structures of the domain Q2A1M7 516-584
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmr X-ray 3.46 C 516-584  L-Mj 
6wmt X-ray 4.43 C 516-584  L-Mj 
6wmp X-ray 2.98 C 516-584  L-Mj 


© NPIDB team 2003 - 2021

text