Pfam domain
Pfam family: RNA_pol_Rpb2_45 (PF10385.11)
Uniprot AC: Q2A1M7
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 594-659
Organism: Francisella tularensis subsp. holarctica
Interaction Mode:   

Sequence:
YRKVVDGKVTDEIEYLSAIDEDNYVIAQASTKLDENNHFVEDIIQCRSGGEAIFTESSRV
QYMDVS
Structures of the domain Q2A1M7 594-659
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmr X-ray 3.46 C 594-659 None
6wmt X-ray 4.43 C 594-659 None
6wmp X-ray 2.98 C 594-659 None


© NPIDB team 2003 - 2021

text