Pfam domain
Pfam family: RNA_pol_Rpb1_4 (PF05000.19)
Uniprot AC: Q2A1M8
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 671-762
Organism: Francisella tularensis subsp. holarctica
Interaction Mode:   

Sequence:
ITENERYNNIINIWSKTSDEVGASMMDAISKDTVSINGEKKEIESFNSVYMMAKSGARGS
YNQMRQLAGMRGLMAKPDGTMIETAITANFRE
Structures of the domain Q2A1M8 671-762
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmr X-ray 3.46 D 671-762 None


© NPIDB team 2003 - 2021

text