Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: Q2A273
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-61
Organism: Francisella tularensis subsp. holarctica
Interaction Mode:   

Sequence:
DCLDKVETRFDLVVLASMRANKILKNGYSESMENEKKEKATVVALREIAESEIT
Structures of the domain Q2A273 8-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmr X-ray 3.46 E 8-61 None
6wmt X-ray 4.43 E 8-61 None
6wmp X-ray 2.98 E 8-61 None


© NPIDB team 2003 - 2021

text