Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: Q2A4H7
RecName: DNA-directed RNA polymerase subunit alpha 2
Begin-End: 27-220
Organism: Francisella tularensis subsp. holarctica
Interaction Mode:   

Sequence:
EALERGVGYTLGFALKQTMLYSIAGACVTSIKINDGKVTSLEDVIPCDETVADIILNVKS
LSVTLAEDVETGTITFELSGSEEEIFSEEAKLSEGLAITEEVFICSYNGGKKLKIEAKVE
KGVGFRPAQDNFKDGEFLLDATFSPVVFCDFEIKDARVGRRTDLDKLELNIKTNGNVNCE
EALRLAATKIQNQL
Structures of the domain Q2A4H7 27-220
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmr X-ray 3.46 B 27-220 None
6wmt X-ray 4.43 B 27-220 None
6wmp X-ray 2.98 B 27-220 None


© NPIDB team 2003 - 2021

text