Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: Q2A5E5
RecName: DNA-directed RNA polymerase subunit alpha 1
Begin-End: 58-154
Organism: Francisella tularensis subsp. holarctica
Interaction Mode:   

Sequence:
IKVNIANVLHEYSTLEDVKEDVVEIVSNLKKVAIKLDTGIDRLDLELSVNKSGVVSAGDF
KTTQGVEIINKDQPIATLTNQRAFSLTATVSVGRNVG
Structures of the domain Q2A5E5 58-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmr X-ray 3.46 A 58-154 None
6wmt X-ray 4.43 A 58-154 None
6wmp X-ray 2.98 A 58-154 None


© NPIDB team 2003 - 2021

text