Pfam domain
Pfam family: HetR_C (PF18460.3)
Uniprot AC: Q2ACK9
RecName: Heterocyst differentiation protein (Fragment)
Begin-End: 191-247
Organism: Fischerella thermalis PCC 7521
Interaction Mode:   

Sequence:
DDQERTYIMVEDTARFFRMMRDWAEKRPNTMRVLEELDILPEKMQQAKDELDEIIRA
Structures of the domain Q2ACK9 191-247
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4izz X-ray 2.5 B 219-297 None
4izz X-ray 2.5 A 219-297 None
4j00 X-ray 3 B 219-297 None
4j00 X-ray 3 A 219-297 None
4j01 X-ray 3.25 F 219-297 None
4j01 X-ray 3.25 E 219-297 None
4j01 X-ray 3.25 A 219-297 None
4j01 X-ray 3.25 B 219-297 None


© NPIDB team 2003 - 2021

text