Pfam domain
Pfam family: Peptidase_S48 (PF03574.17)
Uniprot AC: Q2ACK9
RecName: Heterocyst differentiation protein (Fragment)
Begin-End: 26-174
Organism: Fischerella thermalis PCC 7521
Interaction Mode:   

Sequence:
YLEQGQNLRMTGHLHHLEPKRVKAIVEEVRQALTEGKLLKMLGSQEPRYLIQFPYVWMEK
YPWRPGRSRIPGTSLTSEEKRQIEQKLPSNLPDAHLITSFEFLELIEFLHKRSQEDLPKE
HQMPLSEALAEHIKRRLLYSGTVTRIDSP
Structures of the domain Q2ACK9 26-174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4izz X-ray 2.5 B 54-202 None
4izz X-ray 2.5 A 54-202 None
4j00 X-ray 3 A 54-202  H-Bb H-Mj L-Bb L-Mj 
4j00 X-ray 3 B 54-202  H-Bb H-Mj L-Bb 
4j01 X-ray 3.25 E 54-202  H-Bb H-Mj L-Bb L-Mj 
4j01 X-ray 3.25 F 54-202  H-Bb H-Mj L-Bb L-Mj 
4j01 X-ray 3.25 B 54-202  H-Bb H-Mj L-Bb L-Mj 
4j01 X-ray 3.25 A 54-202  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text