Pfam domain
Pfam family: PhdYeFM_antitox (PF02604.21)
Uniprot AC: Q2G285
RecName: Antitoxin
Begin-End: 1-59
Organism: Staphylococcus aureus
Interaction Mode:  H-Bb H-Mj S-Bb 

Sequence:
MIIKNYSYARQNLKALMTKVNDDSDMVTVTSTDDKNVVIMSESDYNSMMETLYLQQNPN
Structures of the domain Q2G285 1-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6l8e X-ray 2.35 J 1-59  H-Bb H-Mj 
6l8e X-ray 2.35 L 1-57  H-Bb H-Mj S-Bb 
6l8e X-ray 2.35 D 1-55  H-Bb H-Mj S-Bb 


© NPIDB team 2003 - 2021

text