Pfam domain
Pfam family: RNA_pol_Rpb2_1 (PF04563.17)
Uniprot AC: Q2NZX8
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 27-528
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:   

Sequence:
FLLAIQVDSYREFLQEDVESTKRKDLGLHAALKSVFPISSYSGNAALEYVGYKLGQPVFD
ERECRQRGMSYGAPLRVTVRLVIYDRESSTKAIKYVKEQEVYLGEIPLMTGNGTFIVNGT
ERVIVSQLHRSPGVFFDHDRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDALFTRIDRR
RKLPVSILLRALGYNNEEMLAEFFEINTFHINPDEGVQLELVPERLRGETLNFDLADGDK
VIVEAGKRITARHVKQLEAAGVAALAVPDDYLVGRILSHDVVDGSTGELLANANDEISED
QLTAFRKAGVDAVGTLWVNDLDRGPYLSNTLRIDPTKTQLEALVEIYRMMRPGEPPTKEA
AQNLFHNLFFTFERYDLSTVGRMKFNRRVGRKDVLGESVLYDKKYFAERNDEESKRLVAE
HTDTSDILEVIKVLTEIRNGRGVVDDIDHLGNRRVRSVGEMAENVFRVGLVRVERAVKER
LSMAESEGLTPQELINAKPVAA
Structures of the domain Q2NZX8 27-528
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j9f X-ray 3.95 C 28-527 None


© NPIDB team 2003 - 2021

text