Pfam domain
Pfam family: RNA_pol_Rpb2_45 (PF10385.11)
Uniprot AC: Q2NZX8
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 619-684
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:   

Sequence:
YRKVLDGKVSDDVEYLSAIEENEYVIAQANALTDAKNMLTEQFVPCRFQGESLLKPPSEV
HFMDVS
Structures of the domain Q2NZX8 619-684
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j9f X-ray 3.95 C 619-684 None


© NPIDB team 2003 - 2021

text